Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HF572811.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
ETKASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVF GFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQT | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 25,314.530 | ||
Theoretical pI: | 8.766 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 22.402 | ||
aromaticity | 0.124 | ||
GRAVY | -0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.200 | ||
sheet | 0.244 |