Acc_NO	ORF type	length	start-end position (strand +/-)
>HM059807.1	complete	105	160-477(+)
Amino Acid sequence :
MNRLXINERCPTXXRLSXGPPXRGGSVSNVSFQKYNTRFEFFLCSIIQWKRVRKIKFSIHYAVRKVKCSNKNRHPDEVANIVNSNHMSVCNILALKGKLSNIQFR*
Physicochemical properties
Number of amino acids:		105
Molecular weight:		11,637.484
Theoretical pI:		10.794
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8730
Instability index:		38.710
aromaticity		0.090
GRAVY		-0.452
Secondary Structure Fraction
Helix		0.310
turn		0.290
sheet		0.140