Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HM591064.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
KASVGFKAGVKDYRLTYYTPQYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEETQFIAYVAYPLDLFEEGSVTNLFTSIVGNVFGF KALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFCFCAEAIYKAQAETGEIKGHYLN | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 26,150.303 | ||
Theoretical pI: | 7.734 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
Instability index: | 30.663 | ||
aromaticity | 0.124 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.222 | ||
sheet | 0.235 |