Acc_NO	ORF type	length	start-end position (strand +/-)
>HM591068.1	internal	234	1-702(+)
Amino Acid sequence :
KASVGFKAGVKDYRLTYYTPQYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEETQFIAYVAYPLDLFEEGSVTNLFTSIVGNVFGF KALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFCFCAEAIYKAQAETGEIKGHYLN
Physicochemical properties
Number of amino acids:		234
Molecular weight:		26,150.303
Theoretical pI:		7.734
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		37360 37610
Instability index:		30.663
aromaticity		0.124
GRAVY		-0.410
Secondary Structure Fraction
Helix		0.303
turn		0.222
sheet		0.235