Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HM775144.1 | internal | 135 | 1-405(+) |
Amino Acid sequence : | |||
KDRHSKIHTAQGPRDRRMRLSLDIARRFFDLQDKLCYDKASKTVEWLMNKCKSAIEGLGGGRCTALSLSKSPSFASECEAISGLADDKEDEEDHNNDKLLQPVAEMEVGEDVAVNKVKRV ITRSPRKMVINPQAK | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 15,171.152 | ||
Theoretical pI: | 8.702 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 63.290 | ||
aromaticity | 0.037 | ||
GRAVY | -0.730 | ||
Secondary Structure Fraction | |||
Helix | 0.222 | ||
turn | 0.207 | ||
sheet | 0.267 |