Acc_NO	ORF type	length	start-end position (strand +/-)
>HM775144.1	internal	135	1-405(+)
Amino Acid sequence :
KDRHSKIHTAQGPRDRRMRLSLDIARRFFDLQDKLCYDKASKTVEWLMNKCKSAIEGLGGGRCTALSLSKSPSFASECEAISGLADDKEDEEDHNNDKLLQPVAEMEVGEDVAVNKVKRV ITRSPRKMVINPQAK
Physicochemical properties
Number of amino acids:		135
Molecular weight:		15,171.152
Theoretical pI:		8.702
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7240
Instability index:		63.290
aromaticity		0.037
GRAVY		-0.730
Secondary Structure Fraction
Helix		0.222
turn		0.207
sheet		0.267