Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HM775145.1 | internal | 133 | 1-399(+) |
Amino Acid sequence : | |||
KXRHSKIHTAQGPRDRRMRLSLDIARRFFDLQDKLCXDXASKTVEWLMNKCKSAIEGLGXGRXTALSKSPSFASECEAISGLADDKEDEEDHXNDKLLQPVAEMEVGEDVAVNKVKRVIT RSPRKMXIXPQAK | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,076.954 | ||
Theoretical pI: | 8.832 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 67.494 | ||
aromaticity | 0.032 | ||
GRAVY | -0.738 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.192 | ||
sheet | 0.280 |