Acc_NO	ORF type	length	start-end position (strand +/-)
>HM775145.1	internal	133	1-399(+)
Amino Acid sequence :
KXRHSKIHTAQGPRDRRMRLSLDIARRFFDLQDKLCXDXASKTVEWLMNKCKSAIEGLGXGRXTALSKSPSFASECEAISGLADDKEDEEDHXNDKLLQPVAEMEVGEDVAVNKVKRVIT RSPRKMXIXPQAK
Physicochemical properties
Number of amino acids:		133
Molecular weight:		14,076.954
Theoretical pI:		8.832
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		67.494
aromaticity		0.032
GRAVY		-0.738
Secondary Structure Fraction
Helix		0.216
turn		0.192
sheet		0.280