Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HM990153.1 | complete | 361 | 1-1086(+) |
Amino Acid sequence : | |||
MGSATNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVDLAAQLPTTNPDAHVMLDRILRLLTSYAILECRLKTLPNGGVERLYGLAPVCKFLTRNEDGV SMAPLTLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSY PGVENVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPENGKVILAECVLPEAPDTGLATKNVVHIDIIMLAHNPGGKERTEKEFQGLAKAAGFKQFNKACCAYNTWIMELL K* | |||
Physicochemical properties | |||
Number of amino acids: | 361 | ||
Molecular weight: | 14,018.031 | ||
Theoretical pI: | 7.813 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 38.823 | ||
aromaticity | 0.056 | ||
GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.224 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HM990153.1 | complete | 125 | 543-166(-) |
Amino Acid sequence : | |||
MIRHSLVKHFVESWICPMILKCCHPIGFVEGNPSIKNCIFQMVPALHKHFILIHERQRSHGNSILVPSQKLAHRRQAVEALDSAVGERFQAAFEDGIASEKAENPVEHHVRVGVGGGELR GEVDR* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,018.031 | ||
Theoretical pI: | 7.813 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 38.823 | ||
aromaticity | 0.056 | ||
GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.224 | ||
sheet | 0.248 |