Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HO001935.1 | internal | 208 | 3-626(+) |
Amino Acid sequence : | |||
GGGGGITISQVKTLNYNKHSPNILMEPLSNSYTYYTVAWLATVALLIISRRTRRQRKLNPPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGDIMQLKFGSFNVLVASSAETAKIILKTQ DVNFACRPKTAAGKYTTYNYSDITWSPYGAYWRQARKMCLMELFSAKRLESYEYIRVEETNSLLKKIYRSPGEEILLKDMLSDVSLNE | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 23,611.994 | ||
Theoretical pI: | 9.628 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41495 | ||
Instability index: | 45.466 | ||
aromaticity | 0.101 | ||
GRAVY | -0.336 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.264 | ||
sheet | 0.240 |