Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HO001939.1 | complete | 166 | 213-713(+) |
Amino Acid sequence : | |||
MSEHMRISLIDPKFKEQKDRMFAKIRETTLAQDDEISRNIVGLARTRPDIFGTTEEEVSNAVKAEIEKKKDEQPKQVIWDGHTGSIGRTASQAMSQNSGVDDMIDASNIDGRGLPGPAPP PPKPGMPSIRPLPPPPGLALNIPRPPTMVQYPTPTSAAVAAPSSTS* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 15,934.358 | ||
Theoretical pI: | 6.938 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 59.416 | ||
aromaticity | 0.108 | ||
GRAVY | 0.718 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.345 | ||
sheet | 0.216 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HO001939.1 | 3prime_partial | 148 | 445-2(-) |
Amino Acid sequence : | |||
MTCFGCSSFFFSISAFTAFETSSSVVPNISGRVLASPTIFLDISSSWARVVSLILANILSFCSLNLGSIREILMCSDISLMGISSPVIGETTYLVGSLSAGIRSSGLFQFFTIFQSSWLV RSLPVTPCPHYSSHHHSLPALLHLPPPL | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 15,934.358 | ||
Theoretical pI: | 6.938 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 59.416 | ||
aromaticity | 0.108 | ||
GRAVY | 0.718 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.345 | ||
sheet | 0.216 |