Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HQ267432.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
RYWFPEESIYPLASPLLLTMPLDSSFVCTQSTEAFYTYVATSSIACSYFVFPFISHQIWCFFIPSCYREQRRKYAPHLYFFGFCFFFFFLTSFAWVVPNVWHFLYNVGQNTNLLMIKLQP KIYDYIMLTIRILFISLVCSIIPVIVSKLRLCSKLRVMVFSLFTAALTTPPDIWCQIVASFPIFLIIEFAIYV | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 22,744.813 | ||
Theoretical pI: | 8.627 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45880 | ||
Instability index: | 47.497 | ||
aromaticity | 0.212 | ||
GRAVY | 0.782 | ||
Secondary Structure Fraction | |||
Helix | 0.492 | ||
turn | 0.187 | ||
sheet | 0.202 |