Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HQ377507.1 | internal | 148 | 1-444(+) |
Amino Acid sequence : | |||
PIAIELSLPQTGPSSRSKRVVTPPVCATGNWMWQLAKAHVCSNDAGVHQLVNRWLGTHACLEPFILAAHRQLSAMHPIYKLLDPHMRYTLEINGLARQSLINADGVIEACFTPGRYCMEI SAAAYKNWRFDLQGLPADLIQRGTAVPD | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,372.765 | ||
Theoretical pI: | 8.497 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
Instability index: | 56.680 | ||
aromaticity | 0.074 | ||
GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.230 | ||
sheet | 0.284 |