Acc_NO	ORF type	length	start-end position (strand +/-)
>HQ377508.1	internal	155	3-467(+)
Amino Acid sequence :
GLTYLGKNEMSILFPIASRLMKLDLLYAFLDTAAHCFLLQRCPNLEILETRNVVGDRGLEVLGQYCKRLKRLRIERGADDQEMEDEEGAVTHRGLIDLAKGCLELEYMAVYVSDITNEAL EIIGTYLKNLSDFRLVLLDREERITDLPLDNGVRA
Physicochemical properties
Number of amino acids:		155
Molecular weight:		17,649.198
Theoretical pI:		4.833
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8940 9190
Instability index:		33.430
aromaticity		0.065
GRAVY		-0.078
Secondary Structure Fraction
Helix		0.355
turn		0.155
sheet		0.368