Acc_NO	ORF type	length	start-end position (strand +/-)
>HQ385034.1	internal	186	3-560(+)
Amino Acid sequence :
GPRFKKIRRLGALPGLTNKRPKAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKYVHIAGKAKGSTGQVLLQLLEMRLDNILFRLGMASTIPAARQLVNHRHILVNGRIVDI PSYRCKPRDIIMAKDEQKSRTLIQNSLDSSPQAEVPNHLTLHPVQYKGLVNQIIDSKWVGLKINEL
Physicochemical properties
Number of amino acids:		186
Molecular weight:		21,257.616
Theoretical pI:		10.680
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 12950
Instability index:		46.125
aromaticity		0.048
GRAVY		-0.544
Secondary Structure Fraction
Helix		0.306
turn		0.231
sheet		0.237