Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HQ385034.1 | internal | 186 | 3-560(+) |
Amino Acid sequence : | |||
GPRFKKIRRLGALPGLTNKRPKAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKYVHIAGKAKGSTGQVLLQLLEMRLDNILFRLGMASTIPAARQLVNHRHILVNGRIVDI PSYRCKPRDIIMAKDEQKSRTLIQNSLDSSPQAEVPNHLTLHPVQYKGLVNQIIDSKWVGLKINEL | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 21,257.616 | ||
Theoretical pI: | 10.680 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 46.125 | ||
aromaticity | 0.048 | ||
GRAVY | -0.544 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.231 | ||
sheet | 0.237 |