Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HQ839701.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
RYWVKDASSLHLLRVFLNEYCNWNSLLIPKKASSPSSKKNKRLFLFLYNSHVCEYESILVFLRNQCFHLRSTSSGVFLERIYFYRKIERLLNIFVKIKDFGSNLRLVKEPFMHYIRYQKR SILASKGTFLFMKKWKFYLVTFWQWHFSVWFHPRNIYINQLSKHSLEFLGYLSSVRINPYIVRSQILENSFLIHNAIKKFETLVPIIPLIASLAKAKFCNVLGHPVSKPIWTDLSDSNII DRFGRICRNISRYHSGS | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 30,689.644 | ||
Theoretical pI: | 10.110 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57870 58120 | ||
Instability index: | 46.824 | ||
aromaticity | 0.160 | ||
GRAVY | -0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.424 | ||
turn | 0.237 | ||
sheet | 0.191 |