Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HQ853403.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISPSITTKQLFDLYQNTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRVGESLNDLNFEQLEELMENV DNSLKLIRERKYKVISNQIDTYKEKVRNVEEIHRNLLLEFDARQEDPYGGLVEQEGDYNSMLGFPNGGGRILALRLQPNHNHNHHLHSGGGS | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 24,689.637 | ||
Theoretical pI: | 8.860 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 41.960 | ||
aromaticity | 0.066 | ||
GRAVY | -0.820 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.231 | ||
sheet | 0.241 |