Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HQ853436.1 | internal | 204 | 1-612(+) |
Amino Acid sequence : | |||
KKIENSTNRQVTYSKRRNGIFKKAKELTVLCDAKISLIMLSSTRKYHEYTSPNTTTKEMIDQYQSTLGVDIWSTHYEKMQENLRRLKEINNKLRREIRQRTGEDVSGLNLQELCHLQENI SESVAEISARKYHAIKNQTDTCKKKVRNLEEQHGSLVLNLEAKCEEQKYGVVENEGHYNSAVAFANGVHNLYAFRLQPLHPNLQ | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 23,708.573 | ||
Theoretical pI: | 9.171 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
Instability index: | 56.295 | ||
aromaticity | 0.064 | ||
GRAVY | -0.854 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.206 | ||
sheet | 0.260 |