Acc_NO	ORF type	length	start-end position (strand +/-)
>HQ902736.1	internal	266	3-800(+)
Amino Acid sequence :
TFVLDILIPRSVHVEILIQTLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFR ANLWLVEEPCMHYIRYQRKSILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNV LGHPISKPIRAELSDSNIIDRFSRIC
Physicochemical properties
Number of amino acids:		266
Molecular weight:		31,759.945
Theoretical pI:		9.946
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		61420 61670
Instability index:		43.069
aromaticity		0.139
GRAVY		0.075
Secondary Structure Fraction
Helix		0.436
turn		0.218
sheet		0.218