Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HQ902794.1 | internal | 174 | 1-522(+) |
Amino Acid sequence : | |||
LTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIP VAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRG | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 19,361.858 | ||
Theoretical pI: | 6.918 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29130 | ||
Instability index: | 31.573 | ||
aromaticity | 0.115 | ||
GRAVY | -0.283 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.224 | ||
sheet | 0.241 |