Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JB304725.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
LLDLGCHSKVKTNRVKIPEGWELIEPTLRELQAKMREAENDPHDGKRKCEALWPIFKIAHQKSRYIFDLYHRRKEISKELYEFCLDQGYADRNLIAKWKKPGYERLCCLRCMQPRDHNFQ TTCVCRVPKHLREEKVIECVHCGCNGCASGD* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 17,804.481 | ||
Theoretical pI: | 8.713 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24700 | ||
Instability index: | 42.683 | ||
aromaticity | 0.079 | ||
GRAVY | -0.722 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.159 | ||
sheet | 0.245 |