Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JB350445.1 | complete | 193 | 170-751(+) |
Amino Acid sequence : | |||
MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDEALA TVPFLILGNKIDIPYAASEDELRFHLGLTGVTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIN* | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,871.022 | ||
Theoretical pI: | 6.430 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35410 | ||
Instability index: | 24.704 | ||
aromaticity | 0.119 | ||
GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.176 | ||
sheet | 0.290 |