Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JB350838.1 | complete | 170 | 214-726(+) |
Amino Acid sequence : | |||
MDQILNKVGSYWLGQKANKEINSVGDDINSLGSSIEGGAKWLVNKLKGKMQKPLPELLKEYDLPVGIFPRDATNYEFNEETRKLIVYIPAVCEVGYKDSSVLRFSTMVTGYLEKGKLVDI EGIKTKVIVWVKVTCISSEKSKVSFTAGVKKSRSRDAYEVLRDGVGIEKF* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,001.785 | ||
Theoretical pI: | 9.067 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 29.985 | ||
aromaticity | 0.088 | ||
GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.241 | ||
sheet | 0.212 |