Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JC299426.1 | 5prime_partial | 150 | 1-453(+) |
Amino Acid sequence : | |||
LCSNITAHTFTSLQQKMPFKRYVEIGRVALVNYGKDYGKLVVIVDVIDQNRALVDSPDMVRSQMNFKRLSLTDIKIDIKRVPKKKTLVAAMEAADVKGKWESSSWGRKLIVQKRRAALND FDRFKLMLAKIKKAGVVRQELAKLKKETAA* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 17,079.055 | ||
Theoretical pI: | 10.213 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 33.550 | ||
aromaticity | 0.067 | ||
GRAVY | -0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.147 | ||
sheet | 0.253 |