Acc_NO	ORF type	length	start-end position (strand +/-)
>JC299508.1	5prime_partial	170	1-513(+)
Amino Acid sequence :
LLDLGCHSDSSTPFYLSLSLHNPPLLLPADNTSPPIMPFKRYVEIGRVALVNYGEDYGKLVVIVDVIDQNRALVDSPDMVRSQMNFKRLSLTDIKIDIKRVPKKKVLVAAMEAADVKGKW EKSSWGRKLIVQKRRASLNDFDRFKLMLAKIKKAGVVRQELAKLKKETAS*
Physicochemical properties
Number of amino acids:		170
Molecular weight:		19,205.415
Theoretical pI:		9.857
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 16960
Instability index:		36.442
aromaticity		0.065
GRAVY		-0.222
Secondary Structure Fraction
Helix		0.335
turn		0.206
sheet		0.259