Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JC299508.1 | 5prime_partial | 170 | 1-513(+) |
Amino Acid sequence : | |||
LLDLGCHSDSSTPFYLSLSLHNPPLLLPADNTSPPIMPFKRYVEIGRVALVNYGEDYGKLVVIVDVIDQNRALVDSPDMVRSQMNFKRLSLTDIKIDIKRVPKKKVLVAAMEAADVKGKW EKSSWGRKLIVQKRRASLNDFDRFKLMLAKIKKAGVVRQELAKLKKETAS* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,205.415 | ||
Theoretical pI: | 9.857 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 36.442 | ||
aromaticity | 0.065 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.206 | ||
sheet | 0.259 |