Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF519748.1 | internal | 100 | 1-300(+) |
Amino Acid sequence : | |||
EWGQPKSKITHLLFCTTSGXDMPGADYQLTKLLGLRPSVKRVMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQXLF | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,699.290 | ||
Theoretical pI: | 8.971 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 32.246 | ||
aromaticity | 0.071 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.224 | ||
sheet | 0.245 |