Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF519749.1 | 3prime_partial | 174 | 362-883(+) |
Amino Acid sequence : | |||
MEMQVSLAGRLLLTHMGVXXXXXHDRPYKSFSDFIQGKEGRFRENLLGKRVDYSGRSVIVVGPLLSLYQCGLPREIAIELFQAFLIRDLIERQIAPNLRAAKIIIRDRGPIIWNVLKQIM QRHPILLNRAPTLHRLGIQAFIPILIEELAIHLHPLVCAGFNADFDGDQMAVHV | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 11,585.115 | ||
Theoretical pI: | 5.616 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 41.859 | ||
aromaticity | 0.047 | ||
GRAVY | 0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.311 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF519749.1 | 5prime_partial | 144 | 1-435(+) |
Amino Acid sequence : | |||
GHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNGTCPWLRPDGKTQVTXEYRNEGGAMVPERVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPEXYLDENTIFHLNPSGRFVIGGP HGDAGLTGRKIIIDTYGGWXXXXS* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 11,585.115 | ||
Theoretical pI: | 5.616 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 41.859 | ||
aromaticity | 0.047 | ||
GRAVY | 0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.311 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF519749.1 | 3prime_partial | 108 | 324-1(-) |
Amino Acid sequence : | |||
MEDSVLIKVXLWNHRLDDMLLEISSNLVVGDSLIMLSGYENSVHPFRNHGSSFISILXGDLGFAIGPQPGASTILSDLSKLGTELRGQNMSERHELRSLISGIAKHVT | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,585.115 | ||
Theoretical pI: | 5.616 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 41.859 | ||
aromaticity | 0.047 | ||
GRAVY | 0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.311 | ||
sheet | 0.274 |