Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF940681.1 | internal | 190 | 1-570(+) |
Amino Acid sequence : | |||
TKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQG PPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,272.906 | ||
Theoretical pI: | 7.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
Instability index: | 34.872 | ||
aromaticity | 0.116 | ||
GRAVY | -0.365 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.237 | ||
sheet | 0.232 |