Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF940684.1 | internal | 198 | 3-596(+) |
Amino Acid sequence : | |||
TYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPP AYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 22,319.976 | ||
Theoretical pI: | 6.135 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34505 | ||
Instability index: | 34.559 | ||
aromaticity | 0.126 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.232 | ||
sheet | 0.232 |