Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF941939.1 | internal | 175 | 1-525(+) |
Amino Acid sequence : | |||
DYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 19,485.843 | ||
Theoretical pI: | 6.174 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 23.245 | ||
aromaticity | 0.120 | ||
GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.217 | ||
sheet | 0.251 |