Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF944455.1 | internal | 205 | 1-615(+) |
Amino Acid sequence : | |||
GVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRL EDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 23,232.150 | ||
Theoretical pI: | 8.656 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35995 | ||
Instability index: | 25.493 | ||
aromaticity | 0.127 | ||
GRAVY | -0.424 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.210 | ||
sheet | 0.229 |