Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF954039.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
ASSLHLLRLFLHEYSNWNSIITPKNSVLIFSKSNPRLFLFLYNSHVCEYESILLFLRNQPSHLRLMSFGSFFERIFFYAKRKHPVEEVFANDFSVTPWFFKAPFMHYVRYQGKSILASKD TPLLMNKWKYYLIYLWQCYFYVWSQPTRIYINPLSKHSLAFLGYFSSIRLNLSVVRSQMLKNVFIMDNAMKRLDTLVPISPLIGSLAKMKFCNGLGHPVSKSIWADSSDLDIIDRFAHIC RNLSHYYSGSSKKKGLYRIKYILRL | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 31,338.378 | ||
Theoretical pI: | 9.872 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 58330 58580 | ||
Instability index: | 42.216 | ||
aromaticity | 0.166 | ||
GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.415 | ||
turn | 0.249 | ||
sheet | 0.219 |