Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JF956496.1 | internal | 242 | 1-726(+) |
Amino Acid sequence : | |||
ASSLHLLRFFLHEYCSLITSKKPGYSFSTKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLL MNKWKFYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLANSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRNLF HY | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 28,635.902 | ||
Theoretical pI: | 9.619 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41620 | ||
Instability index: | 35.718 | ||
aromaticity | 0.178 | ||
GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
Helix | 0.409 | ||
turn | 0.227 | ||
sheet | 0.194 |