Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645524.1	internal	246	1-738(+)
Amino Acid sequence :
IAPEQELERQDKERMLKLRTLGNIRLIGELLKQKMVPERLVHHIVQELLGHDAKSCPEEENVEAICQFFNTIGKQLDESPKSRRFNDAYFNRLKELTTHPQLAPRLRFMVRNVLDLRTNN WVPRREEVKAKTINEIHSEAEKNLGLRPGSIANMRNGRGAGGVLGGVGPGGFPIARPGSGGMMPGMPGTRRMPGMPGIDNDNWEVPRTRSMPRGEGSAMQASGRGQVSSMSRSATLNSKF LPQGSG
Physicochemical properties
Number of amino acids:		246
Molecular weight:		17,017.927
Theoretical pI:		10.739
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16625
Instability index:		41.609
aromaticity		0.070
GRAVY		0.022
Secondary Structure Fraction
Helix		0.287
turn		0.363
sheet		0.261

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645524.1	5prime_partial	157	737-264(-)
Amino Acid sequence :
PLPCGKNFELSVADLLMDETWPRPLACMAEPSPLGIDRVRGTSQLSLSIPGIPGILLVPGIPGIIPPEPGRAMGKPPGPTPPRTPPAPRPFLMLAMEPGRSPRFFSASEWISFMVFAFTS SRLGTQLLVRRSNTLRTMNLSLGANWGCVVNSFKRLK*
Physicochemical properties
Number of amino acids:		157
Molecular weight:		17,017.927
Theoretical pI:		10.739
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16625
Instability index:		41.609
aromaticity		0.070
GRAVY		0.022
Secondary Structure Fraction
Helix		0.287
turn		0.363
sheet		0.261