Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645525.1 | internal | 226 | 1-678(+) |
Amino Acid sequence : | |||
QPGEPESLVCTAMASMAAALIAKLPNSPYSSSNGIYSTNWCSKNLILPISSVRIRRNGNRSSGQQQHHRRISCGLIEPDGGKLVELIVKESEREAKKKEAMGELPRIKLSRIDMEWVHVL SEGWASPLRGFMRESEFLQTLHFNSLRLDDGSFVNMSVPIVLAIDDAQKQRIGHSDRVALLDAANNPVAILNKIEIYKHNKEERIARTWGTTAPGLPYVDQAITSS | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 11,818.463 | ||
Theoretical pI: | 8.048 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 61.668 | ||
aromaticity | 0.080 | ||
GRAVY | -0.564 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.250 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645525.1 | complete | 100 | 426-124(-) |
Amino Acid sequence : | |||
MKSLEELGFSHESTERTCPPLTQHMNPFHINPRQLYPRQLPHSFLLLRFSLRFLHNQLHQLPSVRFDQPATDPPMMLLLTTTPVPISTDSNRRDRQYEIL* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,818.463 | ||
Theoretical pI: | 8.048 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 61.668 | ||
aromaticity | 0.080 | ||
GRAVY | -0.564 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.250 | ||
sheet | 0.260 |