Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645526.1 | 3prime_partial | 169 | 47-553(+) |
Amino Acid sequence : | |||
MAMRKAAAVIGSRALSSTGLSSQSALSRHLHASPGSKKIVGVFYKANEYAAMNPNFLGCAEGALGIREWLESQGHQYIVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKN LELLLTAGIGSDHVDLKAAAEAGLTVAEVTGSNVVSVAEDELMRILILV | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,032.471 | ||
Theoretical pI: | 5.955 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 24.401 | ||
aromaticity | 0.047 | ||
GRAVY | 0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.225 | ||
sheet | 0.343 |