Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645533.1 | 3prime_partial | 211 | 109-741(+) |
Amino Acid sequence : | |||
MMVSHLEWRMVSLAILLLLVPRFPATSQVHLANEKRVKSAVFLSPMFVLGPGSVENKYYYNIGFPRGHIFLKEFDAEVIDEEGNPVPLHETYLHHWVVERYYALRDVDISKERGDRKLNR PKILSARNSGVCDDNTLGQYFGLGSETRKTATYVPDPYGIEVGNPAIIPDGYEQRWLLNVHAIDTRGVEDPLGCTECRCDLYNITKDESGR | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 24,042.092 | ||
Theoretical pI: | 5.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33140 | ||
Instability index: | 41.644 | ||
aromaticity | 0.100 | ||
GRAVY | -0.337 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.237 | ||
sheet | 0.242 |