Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645542.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
LYLSLLLLAVPLGMAIKLFLPTLFALIFLFLFPTISSASRTPNYQSKIKQWCSQTPFPQPCEFFMTQNQYTFLLETKSDFDKAAMQVALDRALNAKTYTSKLGPKCRNEKEKAAWADCLE LYQDTILKLNNTLHPHRKCNAYDTQTWLSAALTNLQTCISGFRELHVLDFTLPSLISNNNVSKLLSNTLAINKPTPGQRSDELESDKDGFPTWVSGGVRKLLQSSPRANVVVAKDGSGNF GTINAAVDAASKRRGVI | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 12,534.524 | ||
Theoretical pI: | 10.026 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 25.070 | ||
aromaticity | 0.061 | ||
GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.270 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645542.1 | 5prime_partial | 115 | 770-423(-) |
Amino Acid sequence : | |||
ITPLLFEAASTAALMVPKLPDPSLATTTFARGDDCKSFRTPPETQVGNPSLSLSSSSLRCPGVGLLIAKVLLSNLETLLLDMRLGKVKSRTWSSRKPEIQVWRFVRAALSHVWVS* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,534.524 | ||
Theoretical pI: | 10.026 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 25.070 | ||
aromaticity | 0.061 | ||
GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.270 | ||
sheet | 0.287 |