Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645543.1 | internal | 223 | 3-671(+) |
Amino Acid sequence : | |||
ATRAIPFSASTGISSSLSKTLNPSTPLKTLPSNLGFLSSASKSLKSLLSLSSSSASSSVGSAMSSRMMVSVPAVLSSETLDFETSVFTKEKINLAGHDEYIVRGGRNLYNLLPDAFKGIK QIGVIGWGSQGPAQAQNLRDSLAEAKSDIIVKIGLRKGSRSFAEARAAGFSEENGTLGDMWETISGSDLVLLLISDAAQAENFEKIFSLMKPNSILGLSHGFL | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 23,464.410 | ||
Theoretical pI: | 8.875 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 30.823 | ||
aromaticity | 0.063 | ||
GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.341 | ||
sheet | 0.287 |