Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645544.1 | internal | 228 | 1-684(+) |
Amino Acid sequence : | |||
AARAPQDDLMAVDNDSLVAEFEQPPFSLLPSAPNLNPFSLLDANFRRRFFDGRVPADLVGGAPRVTHPREVREIPIEVKDGNSEVGHSGSRPTIEEVSETAHADEPEIRGHVTLNDDDED TQAATGAHSAGQNERSDGFSGNNLHGRHTRSSVPVLDSVADCGDDIEEEMIQAAIEASKREVEGFSDQQFDLTNPRQSHSEDAALAHAVSLSLKTAEQEKVLRQQGGL | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 24,693.482 | ||
Theoretical pI: | 4.575 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 56.504 | ||
aromaticity | 0.039 | ||
GRAVY | -0.673 | ||
Secondary Structure Fraction | |||
Helix | 0.215 | ||
turn | 0.263 | ||
sheet | 0.285 |