Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645546.1 | 3prime_partial | 212 | 81-716(+) |
Amino Acid sequence : | |||
MGNSNEEGLETKEIDIASMSSSRRHGDNNLPQVHKVGLPSRQNLLKEFTSTVKETFFADDPLRHFKDQPRSRKFVLGLQAIFPILEWGRHYNLTKLKGDILAGLTIASLCIPQDIGYAKL ANLDPQYGLYSSFVPPLIYAFMGSSRDIAIGPVAVVSLLLGTLLQNEIDPIKQAEEYRRLAFTATFFAGVTQATLGVLRLGFLIDFLSHAAI | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 23,479.761 | ||
Theoretical pI: | 6.970 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 49.271 | ||
aromaticity | 0.094 | ||
GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.236 | ||
sheet | 0.278 |