Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645551.1 | internal | 219 | 3-659(+) |
Amino Acid sequence : | |||
ITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPTIQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYT SPNEAILCTDSYQSMYTQMFCGLYHREEVLRVGAVFASGLLRAIRFLQLNWQQLADDIASGSLNPKITDPSIRECMSKLMIKPNPELAAFIVKECSSEQ | |||
Physicochemical properties | |||
Number of amino acids: | 219 | ||
Molecular weight: | 24,727.191 | ||
Theoretical pI: | 5.792 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23630 | ||
Instability index: | 51.161 | ||
aromaticity | 0.096 | ||
GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.237 | ||
sheet | 0.274 |