Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645553.1 | internal | 233 | 3-701(+) |
Amino Acid sequence : | |||
GHRRGWCAADERRSEMGQTMSCSSGATPSNDFFRAVKGGNLDTVEVLLHRDPTLLDHTTVFHRLSALHIAAANGRIEVVSMNLERSVDPDVLNRHKQTPLMLAAMYGRISCVQKLLEAGA NILKFDSSRGRTCLHYAAYYGHLDCLKAIISAAHSSPVANSWGFARFVNVRDAKGATPLHLAARQRRPDCVHYLLENGALVNALTGGYGFPESSPLHLAARGGSLDCVRQLLA | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 17,154.394 | ||
Theoretical pI: | 10.408 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 74.275 | ||
aromaticity | 0.058 | ||
GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.273 | ||
sheet | 0.175 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645553.1 | 3prime_partial | 154 | 464-3(-) |
Amino Acid sequence : | |||
MSSRYNGFKTIQMPVISSIMQASSSSRRIKLQNIGTCFQELLHARDPTIHRRQHKRSLFMTIQDIRINRSLQIHRNNLDPTICGGYMKSRESMKDGGVVQESWISVQQDFDSVQVASFNS PKEVIRRSGTGTATHGLTHFAPTLVSGAPPAAVA | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,154.394 | ||
Theoretical pI: | 10.408 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 74.275 | ||
aromaticity | 0.058 | ||
GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.273 | ||
sheet | 0.175 |