Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645555.1 | internal | 264 | 3-794(+) |
Amino Acid sequence : | |||
HSMASLPHTLTTNIVSSNSSSSSSCSLFHPKTSQVNLSGKQIRQRRLVVPRNVTCSSNHKSRENSSSNSINNHHEEYPNALVDRRNVLLGLGAGLYGFAGLNAADRLAVGAPIMPPDLSK CGPADLPAGAKPTDCCPPENFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPNLEIQVHNSWLFFPWHRYYLYFYERILG KLIDDPSFAIPYWNWDSPAGMVLP | |||
Physicochemical properties | |||
Number of amino acids: | 264 | ||
Molecular weight: | 29,246.825 | ||
Theoretical pI: | 8.441 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38765 | ||
Instability index: | 51.893 | ||
aromaticity | 0.095 | ||
GRAVY | -0.354 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.314 | ||
sheet | 0.223 |