Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645561.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
RLLRHPDIVEIKHIMLPPSRRDFKDIYVVFELMESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTANVYHRDLKPKNILANANCKLKICDFGLARVAFSDTPTTIFWTDYVATRWYR APELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVPLAQKFPNADPLALKLLERLLAFDPKDRPTAEEALADPYF KGLA | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 28,238.556 | ||
Theoretical pI: | 9.171 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31650 | ||
Instability index: | 29.613 | ||
aromaticity | 0.111 | ||
GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.168 | ||
sheet | 0.270 |