Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645562.1	internal	230	1-690(+)
Amino Acid sequence :
AASPFQPFLFVVFFILLSLSNAQSSSRPHALVLPVTKDASTLQYVTHINQRTPLVPVDLVFDLGGQFLWVDCEQGYSSSTRRLARCRSSQCSLARANGCGTCTTPGCSNETCILAPDNTV TGTATSGELADDVVAVQSTDGSNPGSAVKVPRFLFSCAPTFLLRGLANGVNGMAGFGRTRIALPTQFSASFSFQRKFAICLSSSTSERGVVFLGDGPYRLLPRFINEDLS
Physicochemical properties
Number of amino acids:		230
Molecular weight:		24,561.639
Theoretical pI:		8.446
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10470
Instability index:		41.381
aromaticity		0.091
GRAVY		0.133
Secondary Structure Fraction
Helix		0.304
turn		0.296
sheet		0.217