Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645586.1 | internal | 208 | 3-626(+) |
Amino Acid sequence : | |||
KPNEGEVQIGEHNVLPNYFEQNQAEALDLNKTVLETVEEVAEDWRVDDIKGLLGRCNFKSDMLDRKVSLLSGGEKARLAFCKFMVKPSTLLVLDEPTNHLDIPSKEMLEEAIAEYKGTVI TVSHDRYFIKQIVNRVVEVKNNILQDYAGDYNYYLEKNLDARERELEREAELEEKAPKVKAKSKMSKAEKEAQKKQKRMAFQQAKAKS | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 11,107.623 | ||
Theoretical pI: | 10.510 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 68.120 | ||
aromaticity | 0.098 | ||
GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.343 | ||
sheet | 0.206 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645586.1 | complete | 102 | 361-53(-) |
Amino Acid sequence : | |||
MTVPLYSAIASSSISFDGMSKWLVGSSKTNKVDGFTMNLQKASRAFSPPLKRETFLSSMSDLKLHRPRSPFISSTLQSSATSSTVSSTVLFKSRASAWFCSK* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,107.623 | ||
Theoretical pI: | 10.510 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 68.120 | ||
aromaticity | 0.098 | ||
GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.343 | ||
sheet | 0.206 |