Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645614.1 | 3prime_partial | 265 | 9-803(+) |
Amino Acid sequence : | |||
MASSLLLRSLRRKDVSAPSLSAYRCLTGNAKTSLAMSPLSQKWASLTRPFSSKPAGNDVIGIDLGTTNSCVAVMEGKNAKVIENSEGARTTPSVVAFNQKGELLVGTPAKRQAVTNPTNT LFGTKRLIGRRYEDPQTQKEMKMVPYKIVKAPNGDAWVEISGKQYSPSQIGAFVLTKMKETAESYLGKTISKAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGLNNKE GIIAVFDLGGGTFDVSILEISNGVF | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 28,408.236 | ||
Theoretical pI: | 9.648 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 40.480 | ||
aromaticity | 0.064 | ||
GRAVY | -0.194 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.272 | ||
sheet | 0.249 |