Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645615.1 | internal | 270 | 3-812(+) |
Amino Acid sequence : | |||
WTAARKIKEMQKIQGPFWSIFHVLIGLLWMTNERNSVYVQADDTVPFNRNSFPKDFIFGTASSAYQYEGGANEGGRGPSVWDTFTHKNPDKIRDGSNGDIAIDSYHQYKEDVRIMKEMGM DAYRFSISWSRILPKGKLSGGVNKEGIKYYNNLINELLSKGIKPFITLFHWDVPQALEDYYAGFLSPLIVNDFRDYADICFKEFGDRVKHWITLNEPWTFSSGGYSLGIHAPGRCSPWVG NCSNGNSGTEPYIVSHHQLLAHAAAVKVYR | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 30,679.265 | ||
Theoretical pI: | 7.861 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 70360 70485 | ||
Instability index: | 19.374 | ||
aromaticity | 0.141 | ||
GRAVY | -0.411 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.278 | ||
sheet | 0.181 |