Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645648.1 | internal | 281 | 1-843(+) |
Amino Acid sequence : | |||
DGSNPLTVVSIPRFIFACAPTLILNGLVKGAVGMAGFGRTRISLPAQFSAAFSIPRKFAMCLSGSTNDEDRGVMFFGNGPYFLLPNKEDLSKALTFTPLLFNPVSTAVSYPLGEPSAEYF IGVKSIKVNDKAISFNNALLTINKTDGYGGTKISTVNPFTVLHTNIYKPFTEAFLKEATAMKLTRVASVAPFGLCFSSKKIAGTRGGPAVPTISLVLQSERVVWRIFGANSMVEVNKDVL CLGFVDGGSNPKTSIVIGGHQLEDNLLEFDVARSRLGFTSS | |||
Physicochemical properties | |||
Number of amino acids: | 281 | ||
Molecular weight: | 12,120.740 | ||
Theoretical pI: | 8.746 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 33.649 | ||
aromaticity | 0.061 | ||
GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.325 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645648.1 | 5prime_partial | 165 | 843-346(-) |
Amino Acid sequence : | |||
RRGKPKPGSSNIKLQQIILQLVPTDNDRRLRVRTPINKSQTQHILVNFNHRVCSKDPPNHSFTLQHKTNCRHSRPTSRTRDLLRAETQPKWCNRRNASEFHSSGFLQESFSERFVNVGMQ NGERIDSTDFSSTVAISFIDGKQSIVKRDGLVINLDGFHSNEVLS* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 12,120.740 | ||
Theoretical pI: | 8.746 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 33.649 | ||
aromaticity | 0.061 | ||
GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.325 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645648.1 | 5prime_partial | 114 | 842-498(-) |
Amino Acid sequence : | |||
EEVNPSLDLATSNSSKLSSNWCPPITIDVLGFEPPSTNPKHNTSLLTSTIEFAPKILQTTLSLCNTRLIVGTAGPPRVPAIFFELKHSPNGATDATRVSFIAVASFKKASVKGL* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,120.740 | ||
Theoretical pI: | 8.746 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 33.649 | ||
aromaticity | 0.061 | ||
GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.325 | ||
sheet | 0.228 |