Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645659.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
EPSSSSSSSSPRFFFPLILLLSLMVFVCNAQTTPPIAPGLSWTFYNTSCPQLETIIRTHLRRVFRNDTGQAAGLLRMHFHDCFVQGCDASVLLDGSAGGPSEKTAPPNLSLRRESFIIIN DLRQRIQNACGRVVSCADILALSARDSIVLSGGPDYRVPLGRRDGLSFATENDTNFNLPAPTAKTDALIPFFAAKNLTVTDLVTLSGGHTIGRSNCTSFSERLYPTQDFTMNLTFASNLR LTCPTNTSSNFTVLDVRT | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 11,239.328 | ||
Theoretical pI: | 11.924 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 26.482 | ||
aromaticity | 0.068 | ||
GRAVY | 0.401 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.252 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645659.1 | 5prime_partial | 103 | 777-466(-) |
Amino Acid sequence : | |||
GVRTSSTVKLLDVLVGHVNLRLLAKVRFMVKSWVGYKRSLNDVQLLLPIVWPPESVTRSVTVRFLAAKKGIRASVFAVGAGRLKLVSFSVAKLSPSRLPNGTL* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,239.328 | ||
Theoretical pI: | 11.924 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 26.482 | ||
aromaticity | 0.068 | ||
GRAVY | 0.401 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.252 | ||
sheet | 0.243 |