Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645677.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
LLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPF VLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLE KAGGGGLEIVVSESG | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 28,090.728 | ||
Theoretical pI: | 7.974 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.068 | ||
aromaticity | 0.098 | ||
GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.302 | ||
sheet | 0.212 |